PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g15670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 132aa    MW: 15481.7 Da    PI: 8.9081
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g15670genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.3e-202173456
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                ++++  +q+++Le+ Fe +++++ +++ ++A++lgL+ rqV +WFqNrRa++k
  CA04g15670 21 KRRLRVDQVQALEKIFEVDNKLDPDRKVKIAQELGLQPRQVAIWFQNRRARWK 73
                4568889*********************************************9 PP

2HD-ZIP_I/II125.62.2e-4020109291
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  kkrrl  +qv++LE+ Fe ++kL+p+rKv++a+eLglqprqva+WFqnrRAR+ktkqlE dy+ Lk++y+al+++ +++e+e+e L +e+
   CA04g15670  20 KKRRLRVDQVQALEKIFEVDNKLDPDRKVKIAQELGLQPRQVAIWFQNRRARWKTKQLEIDYNILKANYEALQHNYSKVEQEKEGLITEV 109
                  9***********************************************************************************998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.4221575IPR001356Homeobox domain
SuperFamilySSF466894.71E-201777IPR009057Homeodomain-like
SMARTSM003892.8E-191879IPR001356Homeobox domain
CDDcd000861.06E-162076No hitNo description
PfamPF000461.9E-172173IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-202573IPR009057Homeodomain-like
PRINTSPR000315.2E-64655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000315.2E-65571IPR000047Helix-turn-helix motif
PfamPF021835.9E-1275110IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MLDGLEDEDG IEESGCGTGK KRRLRVDQVQ ALEKIFEVDN KLDPDRKVKI AQELGLQPRQ  60
VAIWFQNRRA RWKTKQLEID YNILKANYEA LQHNYSKVEQ EKEGLITEVN YKTIKKSSTF  120
YYLKPLPYQF I*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16775RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-135HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016569170.18e-74PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1
RefseqXP_016569171.15e-74PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X2
SwissprotP466671e-41ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBLM1D1G82e-71M1D1G8_SOLTU; Uncharacterized protein
TrEMBLQ9LWB08e-71Q9LWB0_SOLLC; Homeodomain protein
STRINGSolyc04g074700.2.16e-70(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA129391620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-41homeobox protein 16